STK36 Antibody - BSA Free

Immunohistochemistry-Paraffin: STK36 Antibody [NBP1-83410] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STK36 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STK36 Antibody - BSA Free (NBP1-83410) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFACTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK36
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STK36 Protein (NBP1-83410PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STK36 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• Fused homolog
• FUserine/threonine kinase 36, fused homolog
• KIAA1278DKFZp434N0223
• serine/threonine kinase 36 (fused homolog, Drosophila)
• serine/threonine kinase 36
• serine/threonine-protein kinase 36

Background

Serine/threonine protein kinase required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK36