STEAP2 Antibody (1114318) [Unconjugated]

Images

 
STEAP2 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human STEAP2 Monoclonal Antibody (Catalog # MAB11742) at 5 µg/ml for 1 hour at room temperature followed by ...read more
STEAP2 was detected in immersion fixed paraffin-embedded sections of human prostate cander using Mouse Anti-Human STEAP2 Monoclonal Antibody (Catalog # MAB11742) at 5 µg/ml for 1 hour at room temperature followed by ...read more
STEAP2 was detected in immersion fixed LNCaP human prostate cancer cell line (Positive) and absent in MCF‑7 human breast cancer cell line (Negative) using Mouse Anti-Human STEAP2 Monoclonal Antibody (Catalog # ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, ICC/IF
Clone
1114318
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

STEAP2 Antibody (1114318) [Unconjugated] Summary

Immunogen
Synthetic Peptide
Accession # Q8NFT2
Specificity
Detects a synthetic peptide specific for human STEAP-2 around amino acid 460 in Direct ELISA.
Source
N/A
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Purity Statement
Protein A or G purified from cell culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry 3-25 ug/mL
  • Immunohistochemistry 3-25 ug/mL

Packaging, Storage & Formulations

Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Instructions
Reconstitute lyophilized material at 0.2 mg/ml in sterile PBS. For liquid material, refer to CoA for concentration.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for STEAP2 Antibody (1114318) [Unconjugated]

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Background

Six-transmembrane epithelial antigen of the prostate 2 (STEAP2) is a member of the STEAP family of metalloreductases, with a molecular weight of approximately 49 kDa. STEAP2 is an integral membrane protein that plays a role in cellular homeostasis by facilitating the reduction of metal ions such as iron and copper, which are critical cofactors for various enzymatic processes. STEAP2 is highly expressed in prostate tissue and is also detected at lower levels in other tissues, supporting its emerging role in tissue-specific metabolic regulation. Overexpression of STEAP2 has been implicated in prostate cancer progression, where it contributes to the proliferation, migration, and invasiveness of tumor cells. The dysregulation of STEAP2 expression has also been associated with other malignancies, suggesting its broader significance in cancer biology. Additionally, STEAP2 has garnered interest as a potential biomarker for cancer diagnosis and prognosis, as well as a therapeutic target, particularly in prostate and other hormone-regulated cancers.
  1. Hubert RS, Vivanco I, Chen E, Rastegar S, Leong K, Mitchell SC, Madraswala R, Zhou Y, Kuo J, Raitano AB, Jakobovits A, Saffran DC, Afar DE. STEAP: a prostate-specific cell-surface antigen highly expressed in human prostate tumors. Proc Natl Acad Sci U S A. 1999 Dec 7;96(25):14523-8. doi: 10.1073/pnas.96.25.14523. PMID: 10588738; PMCID: PMC24469.
  2. Ohgami RS, Campagna DR, McDonald A, Fleming MD. The Steap proteins are metalloreductases. Blood. 2006 Aug 15;108(4):1388-94. doi: 10.1182/blood-2006-02-003681. Epub 2006 Apr 11. PMID: 16609065; PMCID: PMC1785011.
  3. Gomes IM, Maia CJ, Santos CR. STEAP proteins: from structure to applications in cancer therapy. Mol Cancer Res. 2012 May;10(5):573-87. doi: 10.1158/1541-7786.MCR-11-0281. Epub 2012 Apr 20. PMID: 22522456.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48437
Species: Hu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NB100-68162
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP2-13395
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
5829-ST
Species: Hu
Applications: EnzAct
NBP3-04803
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
375-TL
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF7109
Species: Mu
Applications: IHC, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB

Publications for STEAP2 Antibody (MAB11742) (0)

There are no publications for STEAP2 Antibody (MAB11742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Antibody (MAB11742) (0)

There are no reviews for STEAP2 Antibody (MAB11742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STEAP2 Antibody (MAB11742). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STEAP2 Antibody (1114318) [Unconjugated] and receive a gift card or discount.

Bioinformatics

Uniprot