STEAP2 Antibody (1114318) [Alexa Fluor® 488]

• Reactivity: Hu
• Clone: 1114318
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Alexa Fluor 488

STEAP2 Antibody (1114318) [Alexa Fluor® 488] Summary

• Immunogen: Synthetic Peptide
  Accession # Q8NFT2
• Specificity: Detects a synthetic peptide specific for human STEAP-2 around amino acid 460 in Direct ELISA.
• Source: N/A
• Isotype: IgG2a
• Clonality: Monoclonal
• Host: Mouse
• Purity Statement: Protein A or G purified from cell culture supernatant

Packaging, Storage & Formulations

• Storage: Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 °C as supplied
• Buffer: Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.

Notes

This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for STEAP2 Antibody (1114318) [Alexa Fluor® 488]

• EC 1.16.1
• EC 1.16.1.-
• IPCA1
• metalloreductase STEAP2
• PCANAP1
• PCANAP1STMP
• prostate cancer associated protein 1
• Prostate cancer-associated protein 1
• Protein upregulated in metastatic prostate cancer
• PUMPCn
• six transmembrane epithelial antigen of prostate 2
• six transmembrane epithelial antigen of the prostate 2
• Six-transmembrane epithelial antigen of prostate 2
• SixTransMembrane protein of prostate 1
• STAMP1
• STAMP1IPCA-1
• STEAP2
• STMP

Background

Six-transmembrane epithelial antigen of the prostate 2 (STEAP2) is a member of the STEAP family of metalloreductases, with a molecular weight of approximately 49 kDa. STEAP2 is an integral membrane protein that plays a role in cellular homeostasis by facilitating the reduction of metal ions such as iron and copper, which are critical cofactors for various enzymatic processes. STEAP2 is highly expressed in prostate tissue and is also detected at lower levels in other tissues, supporting its emerging role in tissue-specific metabolic regulation. Overexpression of STEAP2 has been implicated in prostate cancer progression, where it contributes to the proliferation, migration, and invasiveness of tumor cells. The dysregulation of STEAP2 expression has also been associated with other malignancies, suggesting its broader significance in cancer biology. Additionally, STEAP2 has garnered interest as a potential biomarker for cancer diagnosis and prognosis, as well as a therapeutic target, particularly in prostate and other hormone-regulated cancers.

1. Hubert RS, Vivanco I, Chen E, Rastegar S, Leong K, Mitchell SC, Madraswala R, Zhou Y, Kuo J, Raitano AB, Jakobovits A, Saffran DC, Afar DE. STEAP: a prostate-specific cell-surface antigen highly expressed in human prostate tumors. Proc Natl Acad Sci U S A. 1999 Dec 7;96(25):14523-8. doi: 10.1073/pnas.96.25.14523. PMID: 10588738; PMCID: PMC24469.
2. Ohgami RS, Campagna DR, McDonald A, Fleming MD. The Steap proteins are metalloreductases. Blood. 2006 Aug 15;108(4):1388-94. doi: 10.1182/blood-2006-02-003681. Epub 2006 Apr 11. PMID: 16609065; PMCID: PMC1785011.
3. Gomes IM, Maia CJ, Santos CR. STEAP proteins: from structure to applications in cancer therapy. Mol Cancer Res. 2012 May;10(5):573-87. doi: 10.1158/1541-7786.MCR-11-0281. Epub 2012 Apr 20. PMID: 22522456.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for STEAP2 Antibody (FAB11742G). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
   • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Bioinformatics

• Uniprot:
  • Q8NFT2(Human)