STCH Recombinant Protein Antigen

Images

 
There are currently no images for STCH Protein (NBP1-80715PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STCH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPA13.

Source: E. coli

Amino Acid Sequence: AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPA13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80715.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STCH Recombinant Protein Antigen

  • heat shock 70 kDa protein 13
  • heat shock protein 70kDa family, member 13
  • microsomal stress 70 protein ATPase core
  • Microsomal stress-70 protein ATPase core
  • STCHStress-70 protein chaperone microsome-associated 60 kDa protein
  • stress 70 protein chaperone, microsome-associated, 60kD
  • stress 70 protein chaperone, microsome-associated, 60kDa

Background

STCH is encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029978-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13674
Species: Hu
Applications: IHC,  IHC-P
NBP3-14725
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF5770
Species: Hu
Applications: IHC, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-56536
Species: Hu
Applications: IHC,  IHC-P, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-27398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
7707-NP
Species: Hu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB400-129
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC,  IHC-P, IP, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87969
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for STCH Protein (NBP1-80715PEP) (0)

There are no publications for STCH Protein (NBP1-80715PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STCH Protein (NBP1-80715PEP) (0)

There are no reviews for STCH Protein (NBP1-80715PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STCH Protein (NBP1-80715PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STCH Products

Research Areas for STCH Protein (NBP1-80715PEP)

Find related products by research area.

Blogs on STCH

There are no specific blogs for STCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STCH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA13