STAU2 Antibody (6F9)

Western Blot: STAU2 Antibody (6F9) [H00027067-M03] - Analysis of STAU2 expression in HL-60 (Cat # L014V1).

Western Blot: STAU2 Antibody (6F9) [H00027067-M03] - Analysis of STAU2 expression in MES-SA/Dx5 (Cat # L021V1).

ELISA: STAU2 Antibody (6F9) [H00027067-M03] - Detection limit for recombinant GST tagged STAU2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6F9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

STAU2 Antibody (6F9) Summary

• Immunogen: STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP
• Specificity: STAU2 - staufen, RNA binding protein, homolog 2 (Drosophila)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: STAU2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAU2 Antibody (6F9)

• DKFZp781K0371,39K2
• double-stranded RNA-binding protein Staufen homolog 2,39K3
• MGC119606
• staufen (Drosophila, RNA-binding protein) homolog 2
• staufen homolog 2
• staufen, RNA binding protein, homolog 2 (Drosophila)

Background

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAU2
• Entrez:
  • 27067(Human)
• OMIM:
  • 605920(Human)
• Uniprot:
  • NP_055208(Human)