KIF26B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIF26B Antibody [NBP1-90443] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & microtubules.
Immunohistochemistry-Paraffin: KIF26B Antibody [NBP1-90443] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF26B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCHSFIAQTCFGHGEAMAEPVASEFVSSLQNTAVVCREKPKASPDNLLILSEMGDDSFNKAAPIKGCKISTVSKAMVTISNTANLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF26B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIF26B Protein (NBP1-90443PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF26B Antibody

  • kinesin family member 26B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-80900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
46530002
Species: Hu
Applications: ELISA
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81634
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051168-Q01
Species: Hu
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2134
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP2-46044
Species: Hu
Applications: WB, IHC
NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KIF26B Antibody (NBP1-90443) (0)

There are no publications for KIF26B Antibody (NBP1-90443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF26B Antibody (NBP1-90443) (0)

There are no reviews for KIF26B Antibody (NBP1-90443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIF26B Antibody (NBP1-90443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF26B Products

Bioinformatics Tool for KIF26B Antibody (NBP1-90443)

Discover related pathways, diseases and genes to KIF26B Antibody (NBP1-90443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF26B Antibody (NBP1-90443)

Discover more about diseases related to KIF26B Antibody (NBP1-90443).
 

Pathways for KIF26B Antibody (NBP1-90443)

View related products by pathway.

PTMs for KIF26B Antibody (NBP1-90443)

Learn more about PTMs related to KIF26B Antibody (NBP1-90443).

Blogs on KIF26B

There are no specific blogs for KIF26B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF26B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF26B