STARD8 Antibody

Images

 
Western Blot: STARD8 Antibody [NBP1-69098] - Titration: 1.0 ug/ml Positive Control: 293T Whole Cell.
Western Blot: STARD8 Antibody [NBP1-69098] - Lanes: Lane 1 : 30ug STARD8 transfected HEK293T lysate Lane 2: 30ug HEK293T lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STARD8 Antibody Summary

Immunogen
Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STARD8 and was validated on Western blot.
Theoretical MW
122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STARD8 Antibody

  • ARHGAP38
  • Deleted in liver cancer 3 protein
  • DKFZp686H1668
  • DLC3DLC-3
  • KIAA0189stAR-related lipid transfer protein 8
  • StARD8
  • StAR-related lipid transfer (START) domain containing 8
  • START domain containing 8
  • START domain-containing protein 8
  • STARTGAP3
  • START-GAP3

Background

This gene encodes a member of a subfamily of Rho GTPase activating proteins that contain a steroidogenic acute regulatory protein related lipid transfer domain. The encoded protein localizes to focal adhesions and may be involved in regulating cell morphology. This protein may also function as a tumor suppressor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00140735-M04
Species: Hu
Applications: WB, ELISA
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91678
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF

Publications for STARD8 Antibody (NBP1-69098) (0)

There are no publications for STARD8 Antibody (NBP1-69098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD8 Antibody (NBP1-69098) (0)

There are no reviews for STARD8 Antibody (NBP1-69098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD8 Antibody (NBP1-69098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STARD8 Products

Bioinformatics Tool for STARD8 Antibody (NBP1-69098)

Discover related pathways, diseases and genes to STARD8 Antibody (NBP1-69098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD8 Antibody (NBP1-69098)

Discover more about diseases related to STARD8 Antibody (NBP1-69098).
 

Pathways for STARD8 Antibody (NBP1-69098)

View related products by pathway.

PTMs for STARD8 Antibody (NBP1-69098)

Learn more about PTMs related to STARD8 Antibody (NBP1-69098).

Blogs on STARD8

There are no specific blogs for STARD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STARD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD8