STARD3 Antibody

Images

 
Western Blot: STARD3 Antibody [NBP2-86834] - Host: Rabbit. Target Name: STARD3. Sample Tissue: Human Leiomyosarcoma Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STARD3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STARD3. Peptide sequence: AVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
STARD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STARD3 Antibody

  • CAB1
  • es64
  • Metastatic lymph node gene 64 protein
  • metastatic lymph node protein 64
  • MLN 64
  • MLN64FLJ41370
  • Protein CAB1
  • StARD3
  • StAR-related lipid transfer (START) domain containing 3
  • stAR-related lipid transfer protein 3
  • START domain containing 3
  • START domain-containing protein 3
  • steroidogenic acute regulatory protein related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85368
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-00688
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93527
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5489
Species: Hu
Applications: WB, IHC
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
NBP2-30538
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-234
Species: Hu, Mu, Rt
Applications: WB
NBP1-84012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB

Publications for STARD3 Antibody (NBP2-86834) (0)

There are no publications for STARD3 Antibody (NBP2-86834).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD3 Antibody (NBP2-86834) (0)

There are no reviews for STARD3 Antibody (NBP2-86834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD3 Antibody (NBP2-86834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STARD3 Products

Bioinformatics Tool for STARD3 Antibody (NBP2-86834)

Discover related pathways, diseases and genes to STARD3 Antibody (NBP2-86834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD3 Antibody (NBP2-86834)

Discover more about diseases related to STARD3 Antibody (NBP2-86834).
 

Pathways for STARD3 Antibody (NBP2-86834)

View related products by pathway.

PTMs for STARD3 Antibody (NBP2-86834)

Learn more about PTMs related to STARD3 Antibody (NBP2-86834).
 

Research Areas for STARD3 Antibody (NBP2-86834)

Find related products by research area.

Blogs on STARD3

There are no specific blogs for STARD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STARD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD3