Recombinant Human STARD10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STARD10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-291 of Human STARD10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STARD10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STARD10 Protein

  • Antigen NY-CO-28
  • CGI-52
  • MGC14401
  • NY-CO-28
  • PCTP2
  • PCTP-L
  • PCTP-like protein
  • Serologically defined colon cancer antigen 28SDCCAG28
  • StARD10
  • StAR-related lipid transfer (START) domain containing 10
  • StAR-related lipid transfer protein 10
  • START domain containing 10
  • START domain-containing protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
NBP1-85681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-07799
Species: Hu
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for STARD10 Recombinant Protein (H00010809-P01) (0)

There are no publications for STARD10 Recombinant Protein (H00010809-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD10 Recombinant Protein (H00010809-P01) (0)

There are no reviews for STARD10 Recombinant Protein (H00010809-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD10 Recombinant Protein (H00010809-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD10 Products

Bioinformatics Tool for STARD10 Recombinant Protein (H00010809-P01)

Discover related pathways, diseases and genes to STARD10 Recombinant Protein (H00010809-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD10 Recombinant Protein (H00010809-P01)

Discover more about diseases related to STARD10 Recombinant Protein (H00010809-P01).
 

Pathways for STARD10 Recombinant Protein (H00010809-P01)

View related products by pathway.

PTMs for STARD10 Recombinant Protein (H00010809-P01)

Learn more about PTMs related to STARD10 Recombinant Protein (H00010809-P01).

Blogs on STARD10

There are no specific blogs for STARD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STARD10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD10