Recombinant Human STARD10 GST (N-Term) Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-291 of Human STARD10 Source: Wheat Germ (in vitro) Amino Acid Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
STARD10 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
59.4 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human STARD10 GST (N-Term) Protein
Background
STARD10, STAR-related lipid transfer protein 10 or PCTP-like (33 kDa) is a transporter for lipids which specifically shuttles phosphatidylcholine and phosphatidylethanolamine between membranes. Mammalian STARD10 belongs to a family of fifteen START-domain proteins. In these family members, the carboxy terminal START-domain is conserved and functions in lipid binding or as a lipid sensing domain. The specificity for the type of lipid bound differs among family members (e.g., STARD1,3,5 binds Cholesterol, STARD5 binds 25-hydroxycholesterol, STARD2 binds phosphatidylcholine, and STARD11 binds ceramides). STARD proteins have been associated with various cellular processes such as lipid trafficking, lipid metabolism, and cell signaling (1, 2).
STARD10 is broadly expressed in different organs and tissues such as the brain, endocrine tissues, liver, and gastrointestinal tract. STARD10 is regulated by Casein kinase II, which phosphorylates STARD10 at serine 284 leading to decreased lipid transfer activity and reduced membrane association. STARD10 is overexpressed in breast carcinoma cell lines and in primary breast cancers (3). STARD10 has been implicated in the regulation of bile acid homeostasis and more recently in the regulation of insulin secretion from beta-cells (1, 2, 4).
References
1. Alpy, F., & Tomasetto, C. (2005). Give lipids a START: The StAR-related lipid transfer (START) domain in mammals. Journal of Cell Science. https://doi.org/10.1242/jcs.02485
2. Alpy, F., Legueux, F., Tomasetto, C., & Bianchetti, L. (2009). START domain-containing proteins: A review of their role in lipid transport and exchange. Medecine/Sciences. https://doi.org/10.1051/medsci/2009252181
3. Olayioye, M. A., Hoffmann, P., Pomorski, T., Armes, J., Simpson, R. J., Kemp, B. E., ... Visvader, J. E. (2004). The phosphoprotein StarD10 is overexpressed in breast cancer and cooperates with ErbB receptors in cellular transformation. Cancer Research. https://doi.org/10.1158/0008-5472.CAN-03-3731
4. Carrat, G. R., Hu, M., Nguyen-Tu, M. S., Chabosseau, P., Gaulton, K. J., van de Bunt, M., ... Rutter, G. A. (2017). Decreased STARD10 Expression Is Associated with Defective Insulin Secretion in Humans and Mice. American Journal of Human Genetics. https://doi.org/10.1016/j.ajhg.2017.01.011
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for STARD10 Recombinant Protein (H00010809-P01) (0)
There are no publications for STARD10 Recombinant Protein (H00010809-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STARD10 Recombinant Protein (H00010809-P01) (0)
There are no reviews for STARD10 Recombinant Protein (H00010809-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STARD10 Recombinant Protein (H00010809-P01) (0)
Additional STARD10 Products
Blogs on STARD10