STARD10 Recombinant Protein Antigen

Images

 
There are currently no images for STARD10 Recombinant Protein Antigen (NBP1-84508PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STARD10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STARD10.

Source: E. coli

Amino Acid Sequence: MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STARD10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84508.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STARD10 Recombinant Protein Antigen

  • Antigen NY-CO-28
  • CGI-52
  • MGC14401
  • NY-CO-28
  • PCTP2
  • PCTP-L
  • PCTP-like protein
  • SDCCAG28
  • Serologically defined colon cancer antigen 28SDCCAG28
  • STARD10
  • StAR-related lipid transfer (START) domain containing 10
  • StAR-related lipid transfer protein 10
  • START domain containing 10
  • START domain-containing protein 10

Background

STARD10, STAR-related lipid transfer protein 10 or PCTP-like (33 kDa) is a transporter for lipids which specifically shuttles phosphatidylcholine and phosphatidylethanolamine between membranes. Mammalian STARD10 belongs to a family of fifteen START-domain proteins. In these family members, the carboxy terminal START-domain is conserved and functions in lipid binding or as a lipid sensing domain. The specificity for the type of lipid bound differs among family members (e.g., STARD1,3,5 binds Cholesterol, STARD5 binds 25-hydroxycholesterol, STARD2 binds phosphatidylcholine, and STARD11 binds ceramides). STARD proteins have been associated with various cellular processes such as lipid trafficking, lipid metabolism, and cell signaling (1, 2).

STARD10 is broadly expressed in different organs and tissues such as the brain, endocrine tissues, liver, and gastrointestinal tract. STARD10 is regulated by Casein kinase II, which phosphorylates STARD10 at serine 284 leading to decreased lipid transfer activity and reduced membrane association. STARD10 is overexpressed in breast carcinoma cell lines and in primary breast cancers (3). STARD10 has been implicated in the regulation of bile acid homeostasis and more recently in the regulation of insulin secretion from beta-cells (1, 2, 4).

References

1. Alpy, F., & Tomasetto, C. (2005). Give lipids a START: The StAR-related lipid transfer (START) domain in mammals. Journal of Cell Science. https://doi.org/10.1242/jcs.02485

2. Alpy, F., Legueux, F., Tomasetto, C., & Bianchetti, L. (2009). START domain-containing proteins: A review of their role in lipid transport and exchange. Medecine/Sciences. https://doi.org/10.1051/medsci/2009252181

3. Olayioye, M. A., Hoffmann, P., Pomorski, T., Armes, J., Simpson, R. J., Kemp, B. E., ... Visvader, J. E. (2004). The phosphoprotein StarD10 is overexpressed in breast cancer and cooperates with ErbB receptors in cellular transformation. Cancer Research. https://doi.org/10.1158/0008-5472.CAN-03-3731

4. Carrat, G. R., Hu, M., Nguyen-Tu, M. S., Chabosseau, P., Gaulton, K. J., van de Bunt, M., ... Rutter, G. A. (2017). Decreased STARD10 Expression Is Associated with Defective Insulin Secretion in Humans and Mice. American Journal of Human Genetics. https://doi.org/10.1016/j.ajhg.2017.01.011

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1129-ER
Species: Hu
Applications: BA
NBP1-33485
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00058488-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
MAB6860
Species: Hu
Applications: IP, WB
NBP1-31118
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB400-106
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92448
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68884
Species: Hu
Applications: WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)

There are no publications for STARD10 Recombinant Protein Antigen (NBP1-84508PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)

There are no reviews for STARD10 Recombinant Protein Antigen (NBP1-84508PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD10 Products

Blogs on STARD10

There are no specific blogs for STARD10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STARD10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD10