STARD10 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STARD10. Source: E. coli
Amino Acid Sequence: MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
STARD10 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84508. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for STARD10 Recombinant Protein Antigen
Background
STARD10, STAR-related lipid transfer protein 10 or PCTP-like (33 kDa) is a transporter for lipids which specifically shuttles phosphatidylcholine and phosphatidylethanolamine between membranes. Mammalian STARD10 belongs to a family of fifteen START-domain proteins. In these family members, the carboxy terminal START-domain is conserved and functions in lipid binding or as a lipid sensing domain. The specificity for the type of lipid bound differs among family members (e.g., STARD1,3,5 binds Cholesterol, STARD5 binds 25-hydroxycholesterol, STARD2 binds phosphatidylcholine, and STARD11 binds ceramides). STARD proteins have been associated with various cellular processes such as lipid trafficking, lipid metabolism, and cell signaling (1, 2).
STARD10 is broadly expressed in different organs and tissues such as the brain, endocrine tissues, liver, and gastrointestinal tract. STARD10 is regulated by Casein kinase II, which phosphorylates STARD10 at serine 284 leading to decreased lipid transfer activity and reduced membrane association. STARD10 is overexpressed in breast carcinoma cell lines and in primary breast cancers (3). STARD10 has been implicated in the regulation of bile acid homeostasis and more recently in the regulation of insulin secretion from beta-cells (1, 2, 4).
References
1. Alpy, F., & Tomasetto, C. (2005). Give lipids a START: The StAR-related lipid transfer (START) domain in mammals. Journal of Cell Science. https://doi.org/10.1242/jcs.02485
2. Alpy, F., Legueux, F., Tomasetto, C., & Bianchetti, L. (2009). START domain-containing proteins: A review of their role in lipid transport and exchange. Medecine/Sciences. https://doi.org/10.1051/medsci/2009252181
3. Olayioye, M. A., Hoffmann, P., Pomorski, T., Armes, J., Simpson, R. J., Kemp, B. E., ... Visvader, J. E. (2004). The phosphoprotein StarD10 is overexpressed in breast cancer and cooperates with ErbB receptors in cellular transformation. Cancer Research. https://doi.org/10.1158/0008-5472.CAN-03-3731
4. Carrat, G. R., Hu, M., Nguyen-Tu, M. S., Chabosseau, P., Gaulton, K. J., van de Bunt, M., ... Rutter, G. A. (2017). Decreased STARD10 Expression Is Associated with Defective Insulin Secretion in Humans and Mice. American Journal of Human Genetics. https://doi.org/10.1016/j.ajhg.2017.01.011
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)
There are no publications for STARD10 Recombinant Protein Antigen (NBP1-84508PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)
There are no reviews for STARD10 Recombinant Protein Antigen (NBP1-84508PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for STARD10 Recombinant Protein Antigen (NBP1-84508PEP) (0)
Additional STARD10 Products
Blogs on STARD10