ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (1H5)

Images

 
Western Blot: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (1H5) [H00007903-M03] - Analysis of ST8SIA4 expression in human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (1H5) Summary

Immunogen
ST8SIA4 (AAH27866, 1 a.a. - 168 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Specificity
ST8SIA4 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 (1H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ST8SIA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (1H5)

  • Alpha-2,8-sialyltransferase 8D
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
  • EC 2.4.99
  • EC 2.4.99.-
  • polysialyltransferase-1
  • PST1
  • PST1MGC61459
  • PSTMGC34450
  • sialyltransferase 8 (alpha-2, 8-polysialytransferase) D
  • Sialyltransferase 8D
  • Sialytransferase St8Sia IV
  • SIAT8D
  • SIAT8-D
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • ST8SIA4
  • ST8SIAIV
  • ST8SIA-IV

Background

The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00007903-M03
Species: Hu
Applications: WB, ELISA

Publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Products

Bioinformatics Tool for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03)

Discover related pathways, diseases and genes to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03)

Discover more about diseases related to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03).
 

Pathways for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03)

View related products by pathway.

PTMs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03)

Learn more about PTMs related to ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03).
 

Research Areas for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (H00007903-M03)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (1H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ST8SIA4
Entrez
Uniprot