ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
ST6GAL1 (NP_775324.1, 1 a.a. - 175 a.a.) full-length human protein. MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
ST6GAL1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody - Azide and BSA Free
Background
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP sialic acid to galactose-containing substrates. The encoded protein, which is normally found in the Golgi apparatus but which can be proteolytically processed to a soluble form, is involved in the generation of the cell surface carbohydrate determinants and differentiation antigens HB6, CDw75, and CD76. This protein is a member of glycosyltransferase family 29. Three transcript variants encoding two different isoforms have been found for this gene.
This antibody recognizes the CD75 cell surface antigen, an alpha 2,6 sialyated carbohydrate epitope expressed by mature B cells, especially germinal centre B cells, red blood cells and some epithelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: WB
Publications for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P) (0)
There are no publications for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P) (0)
There are no reviews for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Products
Research Areas for ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (H00006480-B01P)
Find related products by research area.
|
Blogs on ST6 Gal Sialyltransferase 1/ST6GAL1/CD75