ST3GAL3 Antibody - BSA Free

Western Blot: ST3GAL3 Antibody [NBP1-60067] - Human Muscle lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ST3GAL3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST3GAL3. Peptide sequence GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ST3GAL3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ST3GAL3 Antibody - BSA Free

• alpha 2,3-sialyltransferase III
• Alpha 2,3-ST 3
• alpha-2,3-sialyltransferase II
• Beta-galactoside alpha-2,3-sialyltransferase 3
• CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
• EC 2.4.99.6
• Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
• Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase
• MRT12
• N-acetyllactosaminide alpha-2,3-sialyltransferase
• Sialyltransferase 6
• Siat3
• SIAT6
• SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase)
• ST3 beta-Gal alpha-2,3-Sialyltransferase 3
• ST3 beta-galactoside alpha-2,3-sialyltransferase 3
• ST3Gal III
• ST3GAL3
• ST3GALII
• ST3GalIII
• St3Gal-III
• ST3N

Background

ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST3GAL3