Recombinant Human SSR3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SSR3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-185 of Human SSR3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYRRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SSR3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSR3 Protein

  • signal sequence receptor, gamma (translocon-associated protein gamma)
  • SSR gamma
  • SSR-gamma
  • translocon-associated protein gamma subunit
  • translocon-associated protein subunit gamma
  • TRAP-complex gamma subunit
  • TRAP-gamma
  • TRAPGSignal sequence receptor subunit gamma

Background

SSR3( AAH17203, 1 a.a. - 186 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69471
Species: Hu
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-46403
Species: Hu
Applications: IHC
126-FL/CF
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-20940
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB6549
Species: Hu
Applications: WB

Publications for SSR3 Recombinant Protein (H00006747-P01) (0)

There are no publications for SSR3 Recombinant Protein (H00006747-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSR3 Recombinant Protein (H00006747-P01) (0)

There are no reviews for SSR3 Recombinant Protein (H00006747-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSR3 Recombinant Protein (H00006747-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSR3 Products

Bioinformatics Tool for SSR3 Recombinant Protein (H00006747-P01)

Discover related pathways, diseases and genes to SSR3 Recombinant Protein (H00006747-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSR3 Recombinant Protein (H00006747-P01)

Discover more about diseases related to SSR3 Recombinant Protein (H00006747-P01).
 

Pathways for SSR3 Recombinant Protein (H00006747-P01)

View related products by pathway.

Blogs on SSR3

There are no specific blogs for SSR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SSR3 Antibody
NBP1-80667
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSR3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR3