SSR2 Antibody


Western Blot: SSR2 Antibody [NBP1-74209] - Mouse Pancreas Lysate 1 ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

SSR2 Antibody Summary

Synthetic peptides corresponding to the C terminal of Ssr2. Immunizing peptide sequence KAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFL.
This product is specific to Subunit or Isoform: beta.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ssr2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SSR2 Antibody

  • DKFZp686F19123
  • Signal sequence receptor subunit beta
  • signal sequence receptor, beta (translocon-associated protein beta)
  • SSR-beta
  • TLAP
  • translocon-associated protein beta
  • translocon-associated protein subunit beta
  • TRAP-beta


TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SSR2 Antibody (NBP1-74209) (0)

There are no publications for SSR2 Antibody (NBP1-74209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSR2 Antibody (NBP1-74209) (0)

There are no reviews for SSR2 Antibody (NBP1-74209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSR2 Antibody (NBP1-74209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SSR2 Products

Bioinformatics Tool for SSR2 Antibody (NBP1-74209)

Discover related pathways, diseases and genes to SSR2 Antibody (NBP1-74209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSR2 Antibody (NBP1-74209)

Discover more about diseases related to SSR2 Antibody (NBP1-74209).

Pathways for SSR2 Antibody (NBP1-74209)

View related products by pathway.

Blogs on SSR2.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SSR2 Antibody and receive a gift card or discount.


Gene Symbol SSR2