Recombinant Human SSPN Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SSPN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-217 of Human SSPN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SSPN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
49.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSPN Protein

  • DAGA5
  • Kirsten-ras associated
  • Kirsten-ras-associated protein
  • KRAGNSPN
  • K-ras oncogene-associated protein
  • microspan
  • nanospan
  • sarcospan (Kras oncogene-associated gene)
  • sarcospan
  • SPN1
  • SPN2

Background

SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown. SSPN( NP_005077, 1 a.a. - 218 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF6868
Species: Hu
Applications: WB, IHC
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF5747
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6465
Species: Hu, Rt
Applications: WB, ICC
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00008082-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SSPN Recombinant Protein (H00008082-P01) (0)

There are no publications for SSPN Recombinant Protein (H00008082-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSPN Recombinant Protein (H00008082-P01) (0)

There are no reviews for SSPN Recombinant Protein (H00008082-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSPN Recombinant Protein (H00008082-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SSPN Recombinant Protein (H00008082-P01)

Discover related pathways, diseases and genes to SSPN Recombinant Protein (H00008082-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSPN Recombinant Protein (H00008082-P01)

Discover more about diseases related to SSPN Recombinant Protein (H00008082-P01).
 

Pathways for SSPN Recombinant Protein (H00008082-P01)

View related products by pathway.

PTMs for SSPN Recombinant Protein (H00008082-P01)

Learn more about PTMs related to SSPN Recombinant Protein (H00008082-P01).

Blogs on SSPN

There are no specific blogs for SSPN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Spt6 Antibody
NB100-2582
SSPN Antibody
NBP2-56991

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSPN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSPN