SRP9 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1). MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SRP9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:1000-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SRP9 Antibody - BSA Free
Background
Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Publications for SRP9 Antibody (NBP2-93528) (0)
There are no publications for SRP9 Antibody (NBP2-93528).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SRP9 Antibody (NBP2-93528) (0)
There are no reviews for SRP9 Antibody (NBP2-93528).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SRP9 Antibody (NBP2-93528) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SRP9 Products
Blogs on SRP9