SRP72 Antibody

Images

 
Western Blot: SRP72 Antibody [NBP1-89498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRP72 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRP72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SRP72 Protein (NBP1-89498PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89498 in the following applications:

Publications
Read Publication using NBP1-89498.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22541560)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerols
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRP72 Antibody

  • signal recognition particle 72kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-57413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61107
Species: Hu
Applications: WB, IP
NBP1-89532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89507
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-89498
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SRP72 Antibody (NBP1-89498)(1)

Review for SRP72 Antibody (NBP1-89498) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89498:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SRP72 NBP1-89498
Enlarge
reviewed by:
Anonymous
WB Human 06/22/2016
View

Summary

ApplicationWestern Blot
SpeciesHuman
Special ApplicationsReview submitted by Dr. Kwon Jeong.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRP72 Antibody (NBP1-89498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRP72 Products

Bioinformatics Tool for SRP72 Antibody (NBP1-89498)

Discover related pathways, diseases and genes to SRP72 Antibody (NBP1-89498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP72 Antibody (NBP1-89498)

Discover more about diseases related to SRP72 Antibody (NBP1-89498).
 

Pathways for SRP72 Antibody (NBP1-89498)

View related products by pathway.

PTMs for SRP72 Antibody (NBP1-89498)

Learn more about PTMs related to SRP72 Antibody (NBP1-89498).

Blogs on SRP72

There are no specific blogs for SRP72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
06/22/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol SRP72