SRP72 Antibody

Western Blot: SRP72 Antibody [NBP1-89498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human prostate shows moderate positivity in cytoplasm granular in glandular cells.

Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SRP72 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA
• Predicted Species: Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRP72
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. SRP72 antibody validated for WB from a verified customer review.
• Control Peptide:

  SRP72 Protein (NBP1-89498PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22541560)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SRP72 Antibody

• signal recognition particle 72kDa

Background

Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SRP72 Antibody (NBP1-89498)(1)

Publication using NBP1-89498

• Kirwan M, Walne AJ, Plagnol V et al. Exome Sequencing Identifies Autosomal-Dominant SRP72 Mutations Associated with Familial Aplasia and Myelodysplasia. Am J Hum Genet 2012-05-04 [PMID: 22541560]

Review for SRP72 Antibody (NBP1-89498) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Anonymous - WB Human 06/22/2016

Summary

• Application: Western Blot
• Species: Human

Bioinformatics

• Gene Symbol: SRP72