SRMS Antibody

Images

 
Western Blot: SRMS Antibody [NBP2-85820] - WB Suggested Anti-SRMS Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRMS Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of SRMS. Peptide sequence: PCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SRMS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRMS Antibody

  • tyrosine-protein kinase Srms
  • C20orf148
  • dJ697K14.1
  • src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
  • SRM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-98675
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
DY1747
Species: Hu
Applications: ELISA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-80405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for SRMS Antibody (NBP2-85820) (0)

There are no publications for SRMS Antibody (NBP2-85820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRMS Antibody (NBP2-85820) (0)

There are no reviews for SRMS Antibody (NBP2-85820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRMS Antibody (NBP2-85820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRMS Products

Bioinformatics Tool for SRMS Antibody (NBP2-85820)

Discover related pathways, diseases and genes to SRMS Antibody (NBP2-85820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRMS Antibody (NBP2-85820)

Discover more about diseases related to SRMS Antibody (NBP2-85820).
 

Pathways for SRMS Antibody (NBP2-85820)

View related products by pathway.

PTMs for SRMS Antibody (NBP2-85820)

Learn more about PTMs related to SRMS Antibody (NBP2-85820).
 

Research Areas for SRMS Antibody (NBP2-85820)

Find related products by research area.

Blogs on SRMS

There are no specific blogs for SRMS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRMS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRMS