SRGAP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SRGAP1 Antibody [NBP2-13377] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SRGAP1 Antibody [NBP2-13377] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRGAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPTDRHPDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDL GSPSLASHPRGLLQNRGLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPP IRRSTSSGQYTGFND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SRGAP1 Protein (NBP2-13377PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGAP1 Antibody

  • ARHGAP13srGAP1
  • FLJ22166
  • KIAA1304SLIT-ROBO Rho GTPase-activating protein 1
  • Rho GTPase-activating protein 13
  • SLIT-ROBO Rho GTPase activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93587
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90852
Species: Hu
Applications: IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-81479
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for SRGAP1 Antibody (NBP2-13377) (0)

There are no publications for SRGAP1 Antibody (NBP2-13377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGAP1 Antibody (NBP2-13377) (0)

There are no reviews for SRGAP1 Antibody (NBP2-13377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SRGAP1 Antibody (NBP2-13377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGAP1 Products

Bioinformatics Tool for SRGAP1 Antibody (NBP2-13377)

Discover related pathways, diseases and genes to SRGAP1 Antibody (NBP2-13377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGAP1 Antibody (NBP2-13377)

Discover more about diseases related to SRGAP1 Antibody (NBP2-13377).
 

Pathways for SRGAP1 Antibody (NBP2-13377)

View related products by pathway.

PTMs for SRGAP1 Antibody (NBP2-13377)

Learn more about PTMs related to SRGAP1 Antibody (NBP2-13377).
 

Research Areas for SRGAP1 Antibody (NBP2-13377)

Find related products by research area.

Blogs on SRGAP1

There are no specific blogs for SRGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGAP1