SREBP2 Recombinant Protein Antigen

Images

 
There are currently no images for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SREBP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SREBP2.

Source: E. coli

Amino Acid Sequence: RATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SREBF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58133.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SREBP2 Recombinant Protein Antigen

  • bHLhd2
  • bHLHd2sterol regulatory element-binding protein 2
  • Class D basic helix-loop-helix protein 2
  • SREBF2
  • SREBP2
  • SREBP2SREBP-2
  • sterol regulatory element binding transcription factor 2
  • Sterol regulatory element-binding transcription factor 2

Background

SREBP2 encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-92206
Species: Hu, Mu
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-01828
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
MAB9120
Species: Hu
Applications: ICC
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPC900
Species: Hu
Applications: ELISA
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP) (0)

There are no publications for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP) (0)

There are no reviews for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SREBP2 Recombinant Protein Antigen (NBP2-58133PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SREBP2 Products

Blogs on SREBP2.

SREBP2 - regulating cholesterol homeostasis and lipid metabolism
Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. ...  Read full blog post.

SREBPs: Global Regulator of Lipid Metabolism
Sterol regulatory element binding proteins (SREBPs) are indirectly required for cholesterol biosynthesis and for uptake and fatty acid biosynthesis. There are three known SREBP isoforms, SREBP1a, 1c and SREBP2; these have different roles in lipid synt...  Read full blog post.

SREBP2: From Cholesterol Homeostasis to Cancer Invasion
Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP...  Read full blog post.

ABCA1 Expression is Down-Regulated by SREBP microRNA
The ABCA1 (ATP-binding cassette transporter-A1) gene encodes a transmembrane protein, which plays a major role in phospholipid homeostasis by regulating cholesterol efflux from the cell. ABCA1 antibody studies have shown ABCA1 expression is up/down re...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SREBP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SREBF2