Recombinant Human SREBP2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human SREBP2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 801-900 of Human SREBP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SREBF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SREBP2 GST (N-Term) Protein

  • bHLhd2
  • bHLHd2sterol regulatory element-binding protein 2
  • Class D basic helix-loop-helix protein 2
  • SREBF2
  • SREBP2
  • SREBP2SREBP-2
  • sterol regulatory element binding transcription factor 2
  • Sterol regulatory element-binding transcription factor 2

Background

SREBF2 - sterol regulatory element binding transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-92206
Species: Hu, Mu
Applications: ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-01828
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
MAB9120
Species: Hu
Applications: ICC
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MPC900
Species: Mu
Applications: ELISA
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for SREBP2 Partial Recombinant Protein (H00006721-Q01) (0)

There are no publications for SREBP2 Partial Recombinant Protein (H00006721-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREBP2 Partial Recombinant Protein (H00006721-Q01) (0)

There are no reviews for SREBP2 Partial Recombinant Protein (H00006721-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SREBP2 Partial Recombinant Protein (H00006721-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SREBP2 Products

Blogs on SREBP2.

SREBP2 - regulating cholesterol homeostasis and lipid metabolism
Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. ...  Read full blog post.

SREBPs: Global Regulator of Lipid Metabolism
Sterol regulatory element binding proteins (SREBPs) are indirectly required for cholesterol biosynthesis and for uptake and fatty acid biosynthesis. There are three known SREBP isoforms, SREBP1a, 1c and SREBP2; these have different roles in lipid synt...  Read full blog post.

SREBP2: From Cholesterol Homeostasis to Cancer Invasion
Sterol-regulatory-element-binding protein 2 (SREBP2) is a transcription factor that regulates cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. HMG-CoA. Along with another transcription factor LXR, SREBP...  Read full blog post.

ABCA1 Expression is Down-Regulated by SREBP microRNA
The ABCA1 (ATP-binding cassette transporter-A1) gene encodes a transmembrane protein, which plays a major role in phospholipid homeostasis by regulating cholesterol efflux from the cell. ABCA1 antibody studies have shown ABCA1 expression is up/down re...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SREBP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SREBF2