SRD5A3 Antibody

Images

 
Western Blot: SRD5A3 Antibody [NBP1-69612] - This Anti-SRD5A3 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRD5A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SRD5A3(steroid 5 alpha-reductase 3) The peptide sequence was selected from the N terminal of SRD5A3. Peptide sequence GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRD5A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SRD5A3 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-69612 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SRD5A3 Antibody

  • 3-oxo-5-alpha-steroid 4-dehydrogenase 3
  • CDG1P
  • EC 1.3.1.-
  • EC 1.3.99.5
  • FLJ13352
  • probable polyprenol reductase
  • S5AR 3
  • SR type 3
  • SRD5A2L1
  • SRD5A2LCDG1Q
  • steroid 5 alpha-reductase 3
  • Steroid 5-alpha-reductase 2-like
  • Steroid 5-alpha-reductase 3

Background

SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1491
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-69612
Species: Hu
Applications: WB

Publications for SRD5A3 Antibody (NBP1-69612)(2)

Reviews for SRD5A3 Antibody (NBP1-69612) (0)

There are no reviews for SRD5A3 Antibody (NBP1-69612). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRD5A3 Antibody (NBP1-69612) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRD5A3 Products

Bioinformatics Tool for SRD5A3 Antibody (NBP1-69612)

Discover related pathways, diseases and genes to SRD5A3 Antibody (NBP1-69612). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRD5A3 Antibody (NBP1-69612)

Discover more about diseases related to SRD5A3 Antibody (NBP1-69612).
 

Pathways for SRD5A3 Antibody (NBP1-69612)

View related products by pathway.

PTMs for SRD5A3 Antibody (NBP1-69612)

Learn more about PTMs related to SRD5A3 Antibody (NBP1-69612).

Blogs on SRD5A3

There are no specific blogs for SRD5A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRD5A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRD5A3
Uniprot