SRD5A3 Antibody

Western Blot: SRD5A3 Antibody [NBP1-69612] - This Anti-SRD5A3 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Discontinued

SRD5A3 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SRD5A3(steroid 5 alpha-reductase 3) The peptide sequence was selected from the N terminal of SRD5A3. Peptide sequence GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRD5A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rat reactivity reported in multiple pieces of scientific literature.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SRD5A3 Antibody

• 3-oxo-5-alpha-steroid 4-dehydrogenase 3
• CDG1P
• EC 1.3.1.-
• EC 1.3.99.5
• FLJ13352
• probable polyprenol reductase
• S5AR 3
• SR type 3
• SRD5A2L1
• SRD5A2LCDG1Q
• steroid 5 alpha-reductase 3
• Steroid 5-alpha-reductase 2-like
• Steroid 5-alpha-reductase 3

Background

SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SRD5A3 Antibody (NBP1-69612)(3)

Publications using NBP1-69612

• Mai Q, Sheng D, Chen C et al. Steroid 5 alpha-reductase 3 (SRD5A3) promotes tumor growth and predicts poor survival of human hepatocellular carcinoma (HCC) Aging (Albany NY) 2020-11-20 [PMID: 33229626] (WB, Human)
  
  Details:
  Western blot analysis performed on human hepatocellular carcinoma and healthy liver samples.
• Castro B, Sanchez P, Torres JM, Ortega E et al. Bisphenol A, bisphenol F and bisphenol S affect differently 5a-reductase expression and dopamine-serotonin systems in the prefrontal cortex of juvenile female rats Environ. Res. 2015-07-14 [PMID: 26186136] (WB, Rat)
• Sanchez P, Castro B, Torres JM et al. Effects of different ethanol-administration regimes on mRNA and protein levels of steroid 5alpha-reductase isozymes in prefrontal cortex of adolescent male rats. Psychopharmacology (Berl.) 2014-04-09 [PMID: 24714925] (WB, Rat)

Bioinformatics

• Gene Symbol: SRD5A3
• Uniprot:
  • Q9H8P0(Human)