Src Recombinant Protein Antigen

Images

 
There are currently no images for Src Protein (NBP2-38165PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Src Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRC.

Source: E. coli

Amino Acid Sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SRC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38165.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Src Recombinant Protein Antigen

  • ASV
  • c-Src
  • EC 2.7.10
  • EC 2.7.10.2
  • pp60c-src
  • Rous sarcoma
  • RSVgp4
  • Src
  • tyrosine kinase pp60c-src
  • tyrosine-protein kinase SRC-1
  • v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
  • v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)

Background

Src is a protein tyrosine kinase known to regulate cellular adhesion. Composed of three major domains; SH2, SH3 and a kinase catalytic domain, Src can be switched from an inactive to an active state though control of its phosphorylation state or through protein-protein interaction. Phosphorylation of Y529 by Csk and Chk inactivates Src, while dephosphorylation of Y529 will modify its conformation to an open active state (1-3). Mutation of Y529 leads to Scr overactivity. Several cancers including colon and breast cancer have been associated with an increase of Src activity (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
236-EG
Species: Hu
Applications: BA
AF4589
Species: Hu
Applications: IHC, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85951
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-38165PEP
Species: Hu
Applications: AC

Publications for Src Protein (NBP2-38165PEP) (0)

There are no publications for Src Protein (NBP2-38165PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Src Protein (NBP2-38165PEP) (0)

There are no reviews for Src Protein (NBP2-38165PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Src Protein (NBP2-38165PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Src Products

Research Areas for Src Protein (NBP2-38165PEP)

Find related products by research area.

Blogs on Src.

Androgen Receptor: What Makes a Man?
Steroid receptors (SRs) are a superfamily of ligand-dependent nuclear transcription factors that activate responsive genes response to hormone. Androgen receptors (ARs) are found in a wide variety of tissues, including reproductive organs, central ner...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Src Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SRC