SPRED2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SPRED2 Antibody [NBP2-68816] - Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neuronal and glial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPRED2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPRED2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6

Reactivity Notes

Mouse 83%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for SPRED2 Antibody - BSA Free

• FLJ31917
• MGC163164
• SPRED2
• Spred-2related sequence
• sprouty-related, EVH1 domain containing 2
• sprouty-related, EVH1 domain-containing protein 2

Background

SPRED2 is a member of the Sprouty (see SPRY1; MIM 602465)/SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade (see MAPK1; MIM 176948) (Nonami et al., 2004 [PubMed 15465815]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPRED2