SPIC Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human SPIC. Peptide sequence: TCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPIC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SPIC Antibody - BSA Free
Background
Controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. Transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. Regulates VCAM1 gene expression
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: WB
Publications for SPIC Antibody (NBP2-84278) (0)
There are no publications for SPIC Antibody (NBP2-84278).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPIC Antibody (NBP2-84278) (0)
There are no reviews for SPIC Antibody (NBP2-84278).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SPIC Antibody (NBP2-84278) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPIC Products
Blogs on SPIC