SPHKAP Recombinant Protein Antigen

Images

 
There are currently no images for SPHKAP Protein (NBP2-30973PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SPHKAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPHKAP.

Source: E.coli

Amino Acid Sequence: AQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPHKAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-30973.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SPHKAP Recombinant Protein Antigen

  • A-kinase anchor protein SPHKAP
  • SKIP
  • sphingosine kinase type 1-interacting protein
  • SPHK1 (sphingosine kinase type 1) interacting protein
  • SPHK1 interactor, AKAP domain containing
  • SPHK1-interactor and AKAP domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-77305
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003636-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP3-00253
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
H00008877-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for SPHKAP Protein (NBP2-30973PEP) (0)

There are no publications for SPHKAP Protein (NBP2-30973PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPHKAP Protein (NBP2-30973PEP) (0)

There are no reviews for SPHKAP Protein (NBP2-30973PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SPHKAP Protein (NBP2-30973PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SPHKAP Products

Array NBP2-30973PEP

Bioinformatics Tool for SPHKAP Protein (NBP2-30973PEP)

Discover related pathways, diseases and genes to SPHKAP Protein (NBP2-30973PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPHKAP Protein (NBP2-30973PEP)

Discover more about diseases related to SPHKAP Protein (NBP2-30973PEP).
 

Pathways for SPHKAP Protein (NBP2-30973PEP)

View related products by pathway.

PTMs for SPHKAP Protein (NBP2-30973PEP)

Learn more about PTMs related to SPHKAP Protein (NBP2-30973PEP).

Blogs on SPHKAP

There are no specific blogs for SPHKAP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SPHKAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPHKAP