Sphingomyelin synthase 1 Antibody

Images

 
Western Blot: Sphingomyelin synthase 1 Antibody [NBP1-60081] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sphingomyelin synthase 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SGMS1(sphingomyelin synthase 1) The peptide sequence was selected from the middle region of SGMS1 (NP_671512). Peptide sequence SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGMS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sphingomyelin synthase 1 Antibody

  • MGC17342
  • MOBProtein Mob
  • phosphatidylcholine:ceramide cholinephosphotransferase 1
  • SMS1EC 2.7.8.27
  • sphingomyelin synthase 1Medulla oblongata-derived protein
  • TMEM23hmob33
  • Transmembrane protein 23MOB1

Background

SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60004
Species: Hu, Mu
Applications: WB
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28745
Species: Hu
Applications: WB, IHC, IP
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32051
Species: Hu
Applications: IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86860
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60081
Species: Hu
Applications: WB

Publications for Sphingomyelin synthase 1 Antibody (NBP1-60081) (0)

There are no publications for Sphingomyelin synthase 1 Antibody (NBP1-60081).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sphingomyelin synthase 1 Antibody (NBP1-60081) (0)

There are no reviews for Sphingomyelin synthase 1 Antibody (NBP1-60081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sphingomyelin synthase 1 Antibody (NBP1-60081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sphingomyelin synthase 1 Products

Bioinformatics Tool for Sphingomyelin synthase 1 Antibody (NBP1-60081)

Discover related pathways, diseases and genes to Sphingomyelin synthase 1 Antibody (NBP1-60081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sphingomyelin synthase 1 Antibody (NBP1-60081)

Discover more about diseases related to Sphingomyelin synthase 1 Antibody (NBP1-60081).
 

Pathways for Sphingomyelin synthase 1 Antibody (NBP1-60081)

View related products by pathway.

PTMs for Sphingomyelin synthase 1 Antibody (NBP1-60081)

Learn more about PTMs related to Sphingomyelin synthase 1 Antibody (NBP1-60081).

Blogs on Sphingomyelin synthase 1

There are no specific blogs for Sphingomyelin synthase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sphingomyelin synthase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGMS1
Entrez
Uniprot