Recombinant Human SPDEF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPDEF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-335 of Human SPDEF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

Protein/Peptide Type
Recombinant Protein
Gene
SPDEF

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPDEF Protein

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor

Background

SPDEF( AAH21299, 1 a.a. - 336 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-58560
Species: Hu
Applications: ICC/IF
NBP1-87780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF

Publications for SPDEF Recombinant Protein (H00025803-P01) (0)

There are no publications for SPDEF Recombinant Protein (H00025803-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDEF Recombinant Protein (H00025803-P01) (0)

There are no reviews for SPDEF Recombinant Protein (H00025803-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDEF Recombinant Protein (H00025803-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPDEF Products

Bioinformatics Tool for SPDEF Recombinant Protein (H00025803-P01)

Discover related pathways, diseases and genes to SPDEF Recombinant Protein (H00025803-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Recombinant Protein (H00025803-P01)

Discover more about diseases related to SPDEF Recombinant Protein (H00025803-P01).
 

Pathways for SPDEF Recombinant Protein (H00025803-P01)

View related products by pathway.

PTMs for SPDEF Recombinant Protein (H00025803-P01)

Learn more about PTMs related to SPDEF Recombinant Protein (H00025803-P01).

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPDEF Antibody
NBP2-56499

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPDEF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDEF