SPATA4 Antibody

Images

 
Immunohistochemistry-Paraffin: SPATA4 Antibody [NBP1-80731] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SPATA4 Antibody [NBP1-80731] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SPATA4 Antibody [NBP1-80731] - Staining in human testis and endometrium tissues using anti-SPATA4 antibody. Corresponding SPATA4 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
Specificity
Specificity of human SPATA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPATA4 Protein (NBP1-80731PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA4 Antibody

  • SPEF1B
  • spermatogenesis associated 4
  • spermatogenesis-associated protein 4
  • testis and spermatogenesis cell related protein 2
  • Testis and spermatogenesis cell-related protein 2
  • Testis spermatocyte apoptosis-related gene 2 protein
  • TSARG2MGC33432

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7547
Species: Hu
Applications: WB, ICC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
355-BM/CF
Species: Hu, Mu, Rt
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-56481
Species: Hu
Applications: ICC/IF
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP2-35006
Species: Hu
NB600-470
Species: Ye
Applications: WB, ELISA
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for SPATA4 Antibody (NBP1-80731) (0)

There are no publications for SPATA4 Antibody (NBP1-80731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA4 Antibody (NBP1-80731) (0)

There are no reviews for SPATA4 Antibody (NBP1-80731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPATA4 Antibody (NBP1-80731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SPATA4 Antibody (NBP1-80731)

Discover related pathways, diseases and genes to SPATA4 Antibody (NBP1-80731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA4 Antibody (NBP1-80731)

Discover more about diseases related to SPATA4 Antibody (NBP1-80731).
 

Pathways for SPATA4 Antibody (NBP1-80731)

View related products by pathway.

PTMs for SPATA4 Antibody (NBP1-80731)

Learn more about PTMs related to SPATA4 Antibody (NBP1-80731).
 

Research Areas for SPATA4 Antibody (NBP1-80731)

Find related products by research area.

Blogs on SPATA4

There are no specific blogs for SPATA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA4