SPATA17 Antibody

Images

 
Western Blot: SPATA17 Antibody [NBP1-83097] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: SPATA17 Antibody [NBP1-83097] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli.
Immunohistochemistry-Paraffin: SPATA17 Antibody [NBP1-83097] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPATA17 Protein (NBP1-83097PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA17 Antibody

  • IQ motif containing H
  • IQCH
  • MSRG11
  • MSRG-11
  • RP11-144C20.1
  • spermatogenesis associated 17
  • spermatogenesis-associated protein 17
  • spermatogenesis-related protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31452
Species: Hu
Applications: WB, IHC, IHC-P
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB4165
Species: Hu
Applications: WB, IHC
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
AF3044
Species: Hu
Applications: WB, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
232-FA/CF
Species: Hu
NBP1-98474
Species: Hu
Applications: WB
NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81252
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPATA17 Antibody (NBP1-83097) (0)

There are no publications for SPATA17 Antibody (NBP1-83097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA17 Antibody (NBP1-83097) (0)

There are no reviews for SPATA17 Antibody (NBP1-83097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPATA17 Antibody (NBP1-83097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA17 Products

Bioinformatics Tool for SPATA17 Antibody (NBP1-83097)

Discover related pathways, diseases and genes to SPATA17 Antibody (NBP1-83097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA17 Antibody (NBP1-83097)

Discover more about diseases related to SPATA17 Antibody (NBP1-83097).
 

Pathways for SPATA17 Antibody (NBP1-83097)

View related products by pathway.

Blogs on SPATA17

There are no specific blogs for SPATA17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA17