SPACA9 Antibody

Images

 
Western Blot: SPACA9 Antibody [NBP2-85793] - Host: Rabbit. Target Name: SOGA1. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlSOGA1 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPACA9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPACA9. Peptide sequence: EPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SOGA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPACA9 Antibody

  • C20orf117
  • chromosome 20 open reading frame 117
  • dJ132F21.1
  • FLJ44670
  • hypothetical protein LOC140710
  • KIAA0889
  • SOGA
  • suppressor of glucose, autophagy associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
DRP300
Species: Hu
Applications: ELISA
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-94456
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-77126
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
251-KG/CF
Species: Hu
Applications: BA
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SPACA9 Antibody (NBP2-85793) (0)

There are no publications for SPACA9 Antibody (NBP2-85793).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPACA9 Antibody (NBP2-85793) (0)

There are no reviews for SPACA9 Antibody (NBP2-85793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPACA9 Antibody (NBP2-85793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPACA9 Products

Bioinformatics Tool for SPACA9 Antibody (NBP2-85793)

Discover related pathways, diseases and genes to SPACA9 Antibody (NBP2-85793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SPACA9 Antibody (NBP2-85793)

View related products by pathway.

Research Areas for SPACA9 Antibody (NBP2-85793)

Find related products by research area.

Blogs on SPACA9

There are no specific blogs for SPACA9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPACA9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOGA1