SPACA9 Antibody - BSA Free

Western Blot: SPACA9 Antibody [NBP2-85793] - Host: Rabbit. Target Name: SOGA1. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlSOGA1 is supported by BioGPS gene expression data to be expressed in OVCAR3

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SPACA9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPACA9 Antibody - BSA Free (NBP2-85793) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPACA9. Peptide sequence: EPGDPEKDTKEKPGLSSRDCNHLGALACQDPPGRQMQRSYTAPDKTGIRV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTCL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SPACA9 Antibody - BSA Free

• C20orf117
• chromosome 20 open reading frame 117
• dJ132F21.1
• FLJ44670
• hypothetical protein LOC140710
• KIAA0889
• SOGA
• suppressor of glucose, autophagy associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTCL2