We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SP8 Recombinant Protein Antigen

Images

 
There are currently no images for SP8 Recombinant Protein Antigen (NBP2-49109PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SP8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SP8.

Source: E. coli

Amino Acid Sequence: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SP8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49109.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SP8 Recombinant Protein Antigen

  • transcription factor Sp8
  • BTD
  • Sp8 transcription factor

Background

SP8 is a gene that codes for a protein with four isoforms, measuring 490, 448, 434, and 508 amino acids in length with weights of approximately 49, 45, 44, and 51 kDa respectively. The protein encoded by SP8 functions as a transcription factor that plays a role in limb development by regulating FGF8 expression in the apical ectodermal ridge. Current studies are being done on diseases and disorders related to this gene including bipolar disorder, brain injuries, and papilloma. SP8 has also been shown to have interactions with HYL, ZNF273, ZNF519, CELA3B, and INTS7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8
Species: Hu, Mu
Applications: BA
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-92428
Species: Hu
Applications: ICC/IF, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
AF6470
Species: Hu, Mu
Applications: IHC, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38967
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-56340
Species: Hu
Applications: ICC/IF
NBP2-31983
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P
NBP1-87201
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
AF4256
Species: Hu
Applications: WB
NBP3-48695
Species: Hu, Mu, Ze
Applications: IHC,  IHC-P, WB
NBP2-49109PEP
Species: Hu
Applications: AC

Publications for SP8 Recombinant Protein Antigen (NBP2-49109PEP) (0)

There are no publications for SP8 Recombinant Protein Antigen (NBP2-49109PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP8 Recombinant Protein Antigen (NBP2-49109PEP) (0)

There are no reviews for SP8 Recombinant Protein Antigen (NBP2-49109PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SP8 Recombinant Protein Antigen (NBP2-49109PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP8 Products

Array NBP2-49109PEP

Blogs on SP8

There are no specific blogs for SP8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SP8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SP8