SP2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SP2. Source: E. coli
Amino Acid Sequence: KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SP2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83054. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SP2 Recombinant Protein Antigen
Background
The Sp transcription factor family includes Sp1, Sp2, Sp3 (SPR-2) and Sp4 (SPR-1). Sp transcription factors share similar structures but do not share similar functions. All four proteins contain a highly conserved DNA-binding domain composed of three zinc fingers at the C-terminus. Sp family members bind the consensus sequence GGGGCGGGGC and other closely related sequences which are known as GC boxes. Sp1, Sp3 and Sp4 share a high affinity for GC boxes while Sp2 does not. Sp2 only weakly binds to GT boxes. Sp1, Sp2 and Sp3 are ubiquitously expressed, while Sp4 is abundantly expressed in brain with limited expression in other tissues. Sp1 and Sp3, but not Sp2 or Sp4, interact with E2, a regulatory element for the b4 subunit of neuronal nicotinic acetylcholine receptors. Sp3 is the only Sp member to inhibit Sp1 and Sp4 mediated transcription. The gene3 encoding human Sp2 maps to chromosome 17p32.3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Ctrl
Species: Mu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for SP2 Protein (NBP1-83054PEP) (0)
There are no publications for SP2 Protein (NBP1-83054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SP2 Protein (NBP1-83054PEP) (0)
There are no reviews for SP2 Protein (NBP1-83054PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SP2 Protein (NBP1-83054PEP) (0)
Additional SP2 Products
Blogs on SP2