SP17 Recombinant Protein Antigen

Images

 
There are currently no images for SP17 Recombinant Protein Antigen (NBP1-85409PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SP17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPA17.

Source: E. coli

Amino Acid Sequence: EQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SPA17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85409.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SP17 Recombinant Protein Antigen

  • Cancer/testis antigen 22
  • CT22SP17-1
  • Sp17-1
  • SP17sperm surface protein Sp17
  • sperm autoantigenic protein 17Sperm protein 17

Background

SP17 encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00054763-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89172
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-47299
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89165
Species: Hu
Applications: IHC,  IHC-P
6507-IL/CF
Species: Hu
Applications: BA
NBP1-89173
Species: Hu
Applications: IHC,  IHC-P
NBP2-14430
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
664-LI
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47924
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-85397
Species: Hu
Applications: IHC,  IHC-P, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB

Publications for SP17 Recombinant Protein Antigen (NBP1-85409PEP) (0)

There are no publications for SP17 Recombinant Protein Antigen (NBP1-85409PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP17 Recombinant Protein Antigen (NBP1-85409PEP) (0)

There are no reviews for SP17 Recombinant Protein Antigen (NBP1-85409PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SP17 Recombinant Protein Antigen (NBP1-85409PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP17 Products

Research Areas for SP17 Recombinant Protein Antigen (NBP1-85409PEP)

Find related products by research area.

Blogs on SP17

There are no specific blogs for SP17, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SP17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SPA17