SP-B/Surfactant Protein B Recombinant Protein Antigen

Images

 
There are currently no images for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SP-B/Surfactant Protein B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFTPB.

Source: E. coli

Amino Acid Sequence: AWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SFTPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33982.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SP-B/Surfactant Protein B Recombinant Protein Antigen

  • 18 kDa pulmonary-surfactant protein
  • 6 kDa protein
  • PSP-B
  • pulmonary surfactant-associated protein B
  • Pulmonary surfactant-associated proteolipid SPL(Phe)
  • SFTB3
  • SFTP3
  • SFTPB
  • SMDP1
  • SP-B surfactant, pulmonary-associated protein B
  • SP-B
  • surfactant protein B

Background

The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87201
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
MAB4077
Species: Hu
Applications: IHC, WB
AF1920
Species: Hu, Mu, Rt
Applications: Simple Western, WB
MAB4218
Species: Hu
Applications: IHC, WB
NBP3-27122
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
251-KG
Species: Hu
Applications: BA
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF3975
Species: Hu
Applications: ICC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-33982PEP
Species: Hu
Applications: AC

Publications for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP) (0)

There are no publications for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP) (0)

There are no reviews for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SP-B/Surfactant Protein B Recombinant Protein Antigen (NBP2-33982PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP-B/Surfactant Protein B Products

Blogs on SP-B/Surfactant Protein B

There are no specific blogs for SP-B/Surfactant Protein B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SP-B/Surfactant Protein B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPB