Somatostatin R4/SSTR4 Antibody

Images

 
Western Blot: Somatostatin R4/SSTR4 Antibody [NBP2-88334] - WB Suggested Anti-SSTR4 Antibody. Titration: 1.25 ug/ml. Positive Control: Jurkat Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Somatostatin R4/SSTR4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Somatostatin R4/SSTR4. Peptide sequence: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SSTR4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for Somatostatin R4/SSTR4 Antibody

  • G-protein coupled receptor
  • Somatostatin R4
  • somatostatin receptor 4
  • somatostatin receptor type 4
  • SomatostatinR4
  • SS4R
  • SS-4-R
  • SS4-R
  • SSTR4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB300-157
Species: Hu, Mu, Rt, Po
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74540
Species: Hu, Mu, Po
Applications: WB, Flow, IHC, IHC-P, ICC
NB300-120
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-37266
Species: Hu, Rt
Applications: WB, ELISA, Flow, CyTOF-ready
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28745
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48817
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)

There are no publications for Somatostatin R4/SSTR4 Antibody (NBP2-88334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)

There are no reviews for Somatostatin R4/SSTR4 Antibody (NBP2-88334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Somatostatin R4/SSTR4 Antibody (NBP2-88334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Somatostatin R4/SSTR4 Products

Bioinformatics Tool for Somatostatin R4/SSTR4 Antibody (NBP2-88334)

Discover related pathways, diseases and genes to Somatostatin R4/SSTR4 Antibody (NBP2-88334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Somatostatin R4/SSTR4 Antibody (NBP2-88334)

Discover more about diseases related to Somatostatin R4/SSTR4 Antibody (NBP2-88334).
 

Pathways for Somatostatin R4/SSTR4 Antibody (NBP2-88334)

View related products by pathway.

PTMs for Somatostatin R4/SSTR4 Antibody (NBP2-88334)

Learn more about PTMs related to Somatostatin R4/SSTR4 Antibody (NBP2-88334).
 

Research Areas for Somatostatin R4/SSTR4 Antibody (NBP2-88334)

Find related products by research area.

Blogs on Somatostatin R4/SSTR4

There are no specific blogs for Somatostatin R4/SSTR4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Somatostatin R4/SSTR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSTR4