SNX12 Antibody (2C10)

Images

 
Western Blot: SNX12 Antibody (2C10) [H00029934-M01] - SNX12 monoclonal antibody (M01), clone 2C10 Analysis of SNX12 expression in HL-60.
Sandwich ELISA: SNX12 Antibody (2C10) [H00029934-M01] - Detection limit for recombinant GST tagged SNX12 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNX12 Antibody (2C10) Summary

Immunogen
SNX12 (AAH20559, 53 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK
Specificity
SNX12 - sorting nexin 12
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNX12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNX12 Antibody (2C10)

  • B-cell CLL/lymphoma 7 protein family member C
  • B-cell CLL/lymphoma 7C

Background

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009146-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-98615
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75670
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13361
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1362
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-88882
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24513
Species: Bv, Ca, Eq, Hu, Mu, Ma-Op, Pm, RM
Applications: IHC, IHC-P, WB
H00029934-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SNX12 Antibody (H00029934-M01) (0)

There are no publications for SNX12 Antibody (H00029934-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX12 Antibody (H00029934-M01) (0)

There are no reviews for SNX12 Antibody (H00029934-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX12 Antibody (H00029934-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX12 Products

Bioinformatics Tool for SNX12 Antibody (H00029934-M01)

Discover related pathways, diseases and genes to SNX12 Antibody (H00029934-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX12 Antibody (H00029934-M01)

Discover more about diseases related to SNX12 Antibody (H00029934-M01).
 

Pathways for SNX12 Antibody (H00029934-M01)

View related products by pathway.

PTMs for SNX12 Antibody (H00029934-M01)

Learn more about PTMs related to SNX12 Antibody (H00029934-M01).
 

Research Areas for SNX12 Antibody (H00029934-M01)

Find related products by research area.

Blogs on SNX12

There are no specific blogs for SNX12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX12 Antibody (2C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX12
Entrez
Uniprot