SNTG1 Antibody

Images

 
Western Blot: SNTG1 Antibody [NBP1-55414] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNTG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SNTG1(syntrophin, gamma 1) The peptide sequence was selected from the middle region of SNTG1. Peptide sequence RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNTG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SNTG1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SNTG1 Antibody

  • G1SYNsyntrophin-4
  • gamma-1-syntrophin
  • gamma1-syntrophin
  • SYN4syntrophin 4
  • syntrophin, gamma 1
  • Syntrophin-4

Background

The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
AF2918
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5659
Species: Hu
Applications: WB
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB120-13258
Species: Mu, Rt
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP1-87519
Species: Hu
Applications: IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-46044
Species: Hu
Applications: WB, IHC
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NB100-1392
Species: Hu
Applications: WB, PEP-ELISA
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-86967
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for SNTG1 Antibody (NBP1-55414) (0)

There are no publications for SNTG1 Antibody (NBP1-55414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNTG1 Antibody (NBP1-55414) (0)

There are no reviews for SNTG1 Antibody (NBP1-55414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNTG1 Antibody (NBP1-55414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNTG1 Products

Bioinformatics Tool for SNTG1 Antibody (NBP1-55414)

Discover related pathways, diseases and genes to SNTG1 Antibody (NBP1-55414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNTG1 Antibody (NBP1-55414)

Discover more about diseases related to SNTG1 Antibody (NBP1-55414).
 

Pathways for SNTG1 Antibody (NBP1-55414)

View related products by pathway.

PTMs for SNTG1 Antibody (NBP1-55414)

Learn more about PTMs related to SNTG1 Antibody (NBP1-55414).

Blogs on SNTG1

There are no specific blogs for SNTG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNTG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNTG1
Uniprot