SNRPN Antibody


Western Blot: SNRPN Antibody [NBP1-74239] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SNRPN Antibody Summary

Synthetic peptides corresponding to the N terminal of SNRPN. Immunizing peptide sequence DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SNRPN and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SNRPN Antibody

  • DKFZp686C0927
  • DKFZp686M12165
  • DKFZp761I1912
  • DKFZp762N022
  • FLJ39265
  • HCERN3FLJ33569
  • MGC29886
  • Prader-Willi syndrome chromosome region
  • PWCR
  • RT-LI
  • Sm protein D
  • Sm protein N
  • small nuclear ribonucleoprotein polypeptide N
  • small nuclear ribonucleoprotein-associated protein N
  • SM-D
  • SmN
  • sm-N
  • SMNFLJ36996
  • tissue-specific splicing protein
  • Tissue-specific-splicing protein


The protein encoded by this gene is one polypeptide of a small nuclear ribonucleoprotein complex and belongs to the snRNP SMB/SMN family. The protein plays a role in pre-mRNA processing, possibly tissue-specific alternative splicing events. Although individual snRNPs are believed to recognize specific nucleic acid sequences through RNA-RNA base pairing, the specific role of this family member is unknown. The protein arises from a bicistronic transcript that also encodes a protein identified as the SNRPN upstream reading frame (SNURF).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SNRPN Antibody (NBP1-74239) (0)

There are no publications for SNRPN Antibody (NBP1-74239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPN Antibody (NBP1-74239) (0)

There are no reviews for SNRPN Antibody (NBP1-74239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRPN Antibody (NBP1-74239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SNRPN Products

Bioinformatics Tool for SNRPN Antibody (NBP1-74239)

Discover related pathways, diseases and genes to SNRPN Antibody (NBP1-74239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPN Antibody (NBP1-74239)

Discover more about diseases related to SNRPN Antibody (NBP1-74239).

Pathways for SNRPN Antibody (NBP1-74239)

View related products by pathway.

PTMs for SNRPN Antibody (NBP1-74239)

Learn more about PTMs related to SNRPN Antibody (NBP1-74239).

Research Areas for SNRPN Antibody (NBP1-74239)

Find related products by research area.

Blogs on SNRPN

There are no specific blogs for SNRPN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SNRPN Antibody and receive a gift card or discount.


Gene Symbol SNRPN