SNRPB2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNRPB2 Antibody [NBP2-58608] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRPB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYI
Specificity
Specificity of human SNRPB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRPB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNRPB2 Recombinant Protein Antigen (NBP2-58608PEP)

Reactivity Notes

Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SNRPB2 Antibody

  • MGC24807
  • MGC45309
  • Msl1
  • small nuclear ribonucleoprotein polypeptide B
  • small nuclear ribonucleoprotein polypeptide B''
  • small nuclear ribonucleoprotein polypeptide B2
  • U2 small nuclear ribonucleoprotein B''
  • U2 snRNP B''

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-76844
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19419
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
NBP2-53095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NBP2-33447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB2695
Species: Hu
Applications: WB
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for SNRPB2 Antibody (NBP2-58608) (0)

There are no publications for SNRPB2 Antibody (NBP2-58608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPB2 Antibody (NBP2-58608) (0)

There are no reviews for SNRPB2 Antibody (NBP2-58608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNRPB2 Antibody (NBP2-58608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNRPB2 Products

Bioinformatics Tool for SNRPB2 Antibody (NBP2-58608)

Discover related pathways, diseases and genes to SNRPB2 Antibody (NBP2-58608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPB2 Antibody (NBP2-58608)

Discover more about diseases related to SNRPB2 Antibody (NBP2-58608).
 

Pathways for SNRPB2 Antibody (NBP2-58608)

View related products by pathway.

Blogs on SNRPB2

There are no specific blogs for SNRPB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPB2