![Western Blot: SNRPA1 Antibody [NBP2-33447] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Western-Blot-NBP2-33447-img0005.jpg "Western Blot: SNRPA1 Antibody [NBP2-33447] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SNRPA1 Antibody - BSA Free (NBP2-33447) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-SNRPA1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SNRPA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. SNRPA1 Antibody is validated for IP from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33447 | Applications | Species |
|---|---|---|
| Tanikawa M, Sanjiv K, et al. The spliceosome U2 snRNP factors promote genome stability through distinct mechanisms; transcription of repair factors and R-loop processing. Oncogenesis 2016-12-19 [PMID: 27991914] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IP | Human | 04/22/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SNRPA1 Antibody (NBP2-33447)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SNRPA1 Antibody [NBP2-33447] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33447-img0006.jpg "Immunocytochemistry/Immunofluorescence: SNRPA1 Antibody [NBP2-33447] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.")
![Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33447] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Immunohistochemistry-Paraffin-NBP2-33447-img0007.jpg "Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33447] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.")
![Western Blot: SNRPA1 Antibody [NBP2-33447] - After indicated time periods of SNRPA1 knockdown, cells were collected and analyzed by western blotting. Forty-eight hours after SNRPA1 depletion, protein expression levels of RAD51 and Chk1 were already reduced. At 24h after siSNRPA1 transfection, gamma-H2AX levels transiently increased and then declined. Image collected and cropped by CiteAb from the following publication (nature.com/articles/oncsis201670), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Knockdown-Validated-NBP2-33447-img0008.jpg "Western Blot: SNRPA1 Antibody [NBP2-33447] - After indicated time periods of SNRPA1 knockdown, cells were collected and analyzed by western blotting. Forty-eight hours after SNRPA1 depletion, protein expression levels of RAD51 and Chk1 were already reduced. At 24h after siSNRPA1 transfection, gamma-H2AX levels transiently increased and then declined. Image collected and cropped by CiteAb from the following publication (nature.com/articles/oncsis201670), licensed under a CC-BY license.")
![Immunoprecipitation: SNRPA1 Antibody [NBP2-33447] - Immunoprecipitation of SNRPA1 using NBP2-33447 or Rabbit IgG isotype control at a 1:100 dilution, followed by pulldown with Protein A magnetic beads. IP image submitted by a verified customer review.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Immunoprecipitation-NBP2-33447-img0009.jpg "Immunoprecipitation: SNRPA1 Antibody [NBP2-33447] - Immunoprecipitation of SNRPA1 using NBP2-33447 or Rabbit IgG isotype control at a 1:100 dilution, followed by pulldown with Protein A magnetic beads. IP image submitted by a verified customer review.")
![Western Blot: SNRPA1 Antibody [NBP2-33447] - Recruitment kinetics of SNRPA1 & SF3A3 after laser microirradiation & SNRPA1-dependent recruitment of RAD51 & BRCA1 to laser tracks. (a) Image-based cytometry reveals increased gamma H2AX formation after 72 h SNRPA1 knockdown in U2OS cells. SNRPA1 knockdown effciency is shown in the bar graph. U2OS cells transiently (b) or stably (c) expressing SNRPA1-GFP were microirradiated & protein recruitment followed in real-time. For transcription & splicing inhibition cells were pretreated with DRB (50 μM) or SSA (100 nM) for at least 1 h before damage induction. Representative confocal images & recruitment kinetics are shown. (d) As in (b & c) but in cells stably expressing SF3A3-GFP. (e) Generation of R-loops at laser tracks visualized by HB-GFP recruitment. HB-GFP recruitment kinetics resemble SNRPA1-GFP. (f) Schematic of SNRPA1 deletion constructs. (g) Representative confocal images of recruitment of wild-type & mutated GFP-tagged SNRPA1 after laser microirradiation. (h) Quantification of recruitment, non-recruitment & displacement of GFP-tagged SNRPA1 fusions. Ten cells were analyzed per condition. (i) Confirmation of siRNA-mediated depletion of SNRPA1 after 48 & 72 h knockdown in cells used in (j). (j) Recruitment of RAD51 & BRCA1 in control & SNRPA1-depleted U2OS cells. U2OS cells were transfected with control or SNRPA1 siRNA & 48 or 72 h later microirradiated, fixed after indicated repair times & stained for gamma H2AX, RAD51 & BRCA1. Representative confocal images & percentage of cells displaying RAD51 & BRCA1 recruitment are shown. Scale bar 5 or 10 μM (i). Statistically significant differences were determined using Student's t-test, *P12 foci), gamma H2AX (>12 foci), BRCA1 (>12 foci) & RPA (>12 foci) positive cells. For each condition, more than 400 cells were analyzed. (c) After indicated time periods of SNRPA1 knockdown, cells were collected & analyzed by western blotting. Forty-eight hours after SNRPA1 depletion, protein expression levels of RAD51 & Chk1 were already reduced. At 24 h after siSNRPA1 transfection, gamma H2AX levels transiently increased & then declined. The error bars represent s.e.m. from three independent experiments (n=3). Statistically significant differences between cells treated with control or splicing factor siRNA were determined using Student's t-test, *P<0.05, **P<0.01. Scale bar is 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27991914), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-33447_rabbit-polyclonal-snrpa1-antibody-31020241611355.jpg "Western Blot: SNRPA1 Antibody [NBP2-33447] - Recruitment kinetics of SNRPA1 & SF3A3 after laser microirradiation & SNRPA1-dependent recruitment of RAD51 & BRCA1 to laser tracks. (a) Image-based cytometry reveals increased gamma H2AX formation after 72 h SNRPA1 knockdown in U2OS cells. SNRPA1 knockdown effciency is shown in the bar graph. U2OS cells transiently (b) or stably (c) expressing SNRPA1-GFP were microirradiated & protein recruitment followed in real-time. For transcription & splicing inhibition cells were pretreated with DRB (50 μM) or SSA (100 nM) for at least 1 h before damage induction. Representative confocal images & recruitment kinetics are shown. (d) As in (b & c) but in cells stably expressing SF3A3-GFP. (e) Generation of R-loops at laser tracks visualized by HB-GFP recruitment. HB-GFP recruitment kinetics resemble SNRPA1-GFP. (f) Schematic of SNRPA1 deletion constructs. (g) Representative confocal images of recruitment of wild-type & mutated GFP-tagged SNRPA1 after laser microirradiation. (h) Quantification of recruitment, non-recruitment & displacement of GFP-tagged SNRPA1 fusions. Ten cells were analyzed per condition. (i) Confirmation of siRNA-mediated depletion of SNRPA1 after 48 & 72 h knockdown in cells used in (j). (j) Recruitment of RAD51 & BRCA1 in control & SNRPA1-depleted U2OS cells. U2OS cells were transfected with control or SNRPA1 siRNA & 48 or 72 h later microirradiated, fixed after indicated repair times & stained for gamma H2AX, RAD51 & BRCA1. Representative confocal images & percentage of cells displaying RAD51 & BRCA1 recruitment are shown. Scale bar 5 or 10 μM (i). Statistically significant differences were determined using Student's t-test, *P12 foci), gamma H2AX (>12 foci), BRCA1 (>12 foci) & RPA (>12 foci) positive cells. For each condition, more than 400 cells were analyzed. (c) After indicated time periods of SNRPA1 knockdown, cells were collected & analyzed by western blotting. Forty-eight hours after SNRPA1 depletion, protein expression levels of RAD51 & Chk1 were already reduced. At 24 h after siSNRPA1 transfection, gamma H2AX levels transiently increased & then declined. The error bars represent s.e.m. from three independent experiments (n=3). Statistically significant differences between cells treated with control or splicing factor siRNA were determined using Student's t-test, *P<0.05, **P<0.01. Scale bar is 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27991914), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
