SNM1 Recombinant Protein Antigen

Images

 
There are currently no images for SNM1 Protein (NBP1-89663PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SNM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCLRE1A.

Source: E.coli

Amino Acid Sequence: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCLRE1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89663.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SNM1 Recombinant Protein Antigen

  • DNA cross-link repair 1A
  • hSNM1
  • hSNM1A
  • KIAA0086SNM1 homolog A
  • PSO2 homolog
  • SNM1S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03563
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-183
Species: Hu
Applications: WB
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, ICC, KO
NBP2-57595
Species: Hu
Applications: ICC/IF
NBP2-67597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00051692-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC

Publications for SNM1 Protein (NBP1-89663PEP) (0)

There are no publications for SNM1 Protein (NBP1-89663PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNM1 Protein (NBP1-89663PEP) (0)

There are no reviews for SNM1 Protein (NBP1-89663PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SNM1 Protein (NBP1-89663PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-89663PEP

Bioinformatics Tool for SNM1 Protein (NBP1-89663PEP)

Discover related pathways, diseases and genes to SNM1 Protein (NBP1-89663PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNM1 Protein (NBP1-89663PEP)

Discover more about diseases related to SNM1 Protein (NBP1-89663PEP).
 

Pathways for SNM1 Protein (NBP1-89663PEP)

View related products by pathway.

Research Areas for SNM1 Protein (NBP1-89663PEP)

Find related products by research area.

Blogs on SNM1

There are no specific blogs for SNM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
SNM1 Antibody
NBP1-89663
Mre11 Antibody
NB100-142
FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SNM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCLRE1A