SNAP29 Antibody - BSA Free

Western Blot: SNAP29 Antibody [NBP2-58573] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: SNAP29 Antibody [NBP2-58573] - Staining of human cell line U-2 OS shows localization to cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNAP29 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNAP29
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SNAP29 Recombinant Protein Antigen (NBP2-58573PEP)

Reactivity Notes

Mouse 86%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNAP29 Antibody - BSA Free

• CEDNIK
• CEDNIKSoluble 29 kDa NSF attachment protein
• SNAP29
• SNAP-29FLJ21051
• synaptosomal-associated protein 29
• synaptosomal-associated protein, 29kD
• synaptosomal-associated protein, 29kDa
• Vesicle-membrane fusion protein SNAP-29

Background

SNAP29 (Synaptosomal-associated protein, 29kDa) is involved in multiple membrane trafficking steps and binds tightly to multiple syntaxins. It may act as a negative modulator for neurotransmitter release by slowing recycling of the SNARE-based fusion machinery and synaptic vesicle turnover.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNAP29