SNAP47 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNAP47 Antibody [NBP1-88483] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SNAP47 Antibody [NBP1-88483] - Staining of human esophagus shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNAP47 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DDIKVHSPYEISIRQRFIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVLRSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNAP47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNAP47 Protein (NBP1-88483PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNAP47 Antibody

  • C1orf142
  • Epididymis luminal protein 170
  • FLJ12517
  • HEL170
  • SNAP-47chromosome 1 open reading frame 142
  • SVAP1DKFZp686M10160
  • Synaptosomal-associated 47 kDa protein
  • synaptosomal-associated protein 47
  • synaptosomal-associated protein, 47kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7869
Species: Hu
Applications: WB, ICC
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-54851
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88483
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SNAP47 Antibody (NBP1-88483) (0)

There are no publications for SNAP47 Antibody (NBP1-88483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP47 Antibody (NBP1-88483) (0)

There are no reviews for SNAP47 Antibody (NBP1-88483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNAP47 Antibody (NBP1-88483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAP47 Products

Bioinformatics Tool for SNAP47 Antibody (NBP1-88483)

Discover related pathways, diseases and genes to SNAP47 Antibody (NBP1-88483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAP47 Antibody (NBP1-88483)

Discover more about diseases related to SNAP47 Antibody (NBP1-88483).
 

Pathways for SNAP47 Antibody (NBP1-88483)

View related products by pathway.

PTMs for SNAP47 Antibody (NBP1-88483)

Learn more about PTMs related to SNAP47 Antibody (NBP1-88483).

Blogs on SNAP47

There are no specific blogs for SNAP47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAP47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAP47