SNAP29 Antibody

Images

 
Western Blot: SNAP29 Antibody [NBP1-69180] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNAP29 Antibody Summary

Immunogen
Synthetic peptides corresponding to SNAP29 (synaptosomal-associated protein, 29kDa) The peptide sequence was selected from the middle region of SNAP29. Peptide sequence QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNAP29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SNAP29 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SNAP29 Antibody

  • CEDNIK
  • CEDNIKSoluble 29 kDa NSF attachment protein
  • SNAP29
  • SNAP-29FLJ21051
  • synaptosomal-associated protein 29
  • synaptosomal-associated protein, 29kD
  • synaptosomal-associated protein, 29kDa
  • Vesicle-membrane fusion protein SNAP-29

Background

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88483
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
AF5354
Species: Hu
Applications: WB, IHC
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45925
Species: Hu, Mu, Ca
Applications: WB, IF

Publications for SNAP29 Antibody (NBP1-69180) (0)

There are no publications for SNAP29 Antibody (NBP1-69180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP29 Antibody (NBP1-69180) (0)

There are no reviews for SNAP29 Antibody (NBP1-69180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAP29 Antibody (NBP1-69180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAP29 Products

Bioinformatics Tool for SNAP29 Antibody (NBP1-69180)

Discover related pathways, diseases and genes to SNAP29 Antibody (NBP1-69180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAP29 Antibody (NBP1-69180)

Discover more about diseases related to SNAP29 Antibody (NBP1-69180).
 

Pathways for SNAP29 Antibody (NBP1-69180)

View related products by pathway.

PTMs for SNAP29 Antibody (NBP1-69180)

Learn more about PTMs related to SNAP29 Antibody (NBP1-69180).
 

Research Areas for SNAP29 Antibody (NBP1-69180)

Find related products by research area.

Blogs on SNAP29

There are no specific blogs for SNAP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAP29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAP29
Entrez
Uniprot