SMUG1 Antibody (4D5)

Images

 
Western Blot: SMUG1 Antibody (4D5) [H00023583-M07] - Analysis of SMUG1 expression in human colon.
Western Blot: SMUG1 Antibody (4D5) [H00023583-M07] - Analysis of SMUG1 expression in transfected 293T cell line by SMUG1 monoclonal antibody (M07), clone 4D5. Lane 1: SMUG1 transfected lysate (Predicted MW: 19.6 KDa). ...read more
Sandwich ELISA: SMUG1 Antibody (4D5) [H00023583-M07] - Detection limit for recombinant GST tagged SMUG1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMUG1 Antibody (4D5) Summary

Immunogen
SMUG1 (AAH00417.1, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMUG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is useful for ELISA, Western Blot
Publications
Read Publication using
H00023583-M07 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMUG1 Antibody (4D5)

  • EC 3.2.2
  • EC 3.2.2.-
  • FDG
  • HMUDG
  • MGC104370
  • single-strand selective monofunctional uracil DNA glycosylase
  • single-strand-selective monofunctional uracil-DNA glycosylase 1
  • UNG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF321
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
H00008731-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF4478
Species: Hu
Applications: WB, IHC
NB600-1468
Species: Hu
Applications: WB, IHC, IHC-P, S-ELISA
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SMUG1 Antibody (H00023583-M07)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SMUG1 Antibody (H00023583-M07) (0)

There are no reviews for SMUG1 Antibody (H00023583-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMUG1 Antibody (H00023583-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMUG1 Products

Bioinformatics Tool for SMUG1 Antibody (H00023583-M07)

Discover related pathways, diseases and genes to SMUG1 Antibody (H00023583-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMUG1 Antibody (H00023583-M07)

Discover more about diseases related to SMUG1 Antibody (H00023583-M07).
 

Pathways for SMUG1 Antibody (H00023583-M07)

View related products by pathway.

PTMs for SMUG1 Antibody (H00023583-M07)

Learn more about PTMs related to SMUG1 Antibody (H00023583-M07).
 

Research Areas for SMUG1 Antibody (H00023583-M07)

Find related products by research area.

Blogs on SMUG1

There are no specific blogs for SMUG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMUG1 Antibody (4D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMUG1
Uniprot