SMEK2 Antibody

Images

 
Western Blot: SMEK2 Antibody [NBP1-79673] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMEK2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human Smek2The immunogen for this antibody is Smek2. Peptide sequence DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMEK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Smek2 and was validated on Western blot.
Theoretical MW
90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMEK2 Antibody

  • FLFL2
  • FLJ31474
  • KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B
  • PP4R3B
  • PPP4R3B
  • PSY2
  • SMEK homolog 2
  • SMEK homolog 2, suppressor of mek1 (Dictyostelium)
  • smk1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5074
Species: Hu
Applications: WB
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-2879
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for SMEK2 Antibody (NBP1-79673) (0)

There are no publications for SMEK2 Antibody (NBP1-79673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMEK2 Antibody (NBP1-79673) (0)

There are no reviews for SMEK2 Antibody (NBP1-79673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMEK2 Antibody (NBP1-79673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMEK2 Products

Bioinformatics Tool for SMEK2 Antibody (NBP1-79673)

Discover related pathways, diseases and genes to SMEK2 Antibody (NBP1-79673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMEK2 Antibody (NBP1-79673)

Discover more about diseases related to SMEK2 Antibody (NBP1-79673).
 

Pathways for SMEK2 Antibody (NBP1-79673)

View related products by pathway.

PTMs for SMEK2 Antibody (NBP1-79673)

Learn more about PTMs related to SMEK2 Antibody (NBP1-79673).

Blogs on SMEK2

There are no specific blogs for SMEK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMEK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMEK2
Uniprot