Recombinant Human SMC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 366-465 of Human SMC1L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMC1A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMC1 Protein

  • CDLS2
  • DXS423ESMC1 structural maintenance of chromosomes 1-like 1 (yeast)
  • KIAA0178DKFZp686L19178
  • SB1.8
  • SB1.8MGC138332
  • segregation of mitotic chromosomes 1
  • SMC protein 1A
  • SMC1 (structural maintenance of chromosomes 1, yeast)-like 1
  • SMC1 structural maintenance of chromosomes 1-like 1
  • SMC1
  • SMC1A
  • SMC-1A
  • SMC-1-alpha
  • SMC1L1
  • SMC1SMC1alpha
  • Smcb
  • structural maintenance of chromosomes 1A
  • structural maintenance of chromosomes protein 1A

Background

SMC1L1 - SMC1 structural maintenance of chromosomes 1-like 1 (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85110
Species: Hu
Applications: ICC/IF, IHC, IF
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-300
Species: Hu, Xp
Applications: WB, ICC/IF
NB100-298
Species: Hu, Xp
Applications: WB, ICC/IF, PLA
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008243-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SMC1 Partial Recombinant Protein (H00008243-Q01) (0)

There are no publications for SMC1 Partial Recombinant Protein (H00008243-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMC1 Partial Recombinant Protein (H00008243-Q01) (0)

There are no reviews for SMC1 Partial Recombinant Protein (H00008243-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMC1 Partial Recombinant Protein (H00008243-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I would like to use one of your anti-smc1 antibodies to detect smc1 in an invertebrate. Your different antibodies are raised against different peptides derived from different regions possibly well-conserved, but not completely, in the organism that interests me (Schistosoma mansoni). Would it be possible to know the sequence of the different peptides that was used to generate the different antibodies, or failing that, could you analyze the corresponding sequence in my species of interest in order to determine whether or not it corresponds to one of the different peptides?
    • My suggestion to you would be to look at the homology between the protein expressed in your species and the protein expressed in the reactive species of the antibodies. A homology of >90% is a great start, >80% is acceptable. Please view our list of smc1 antibodies we currently offer and there are 27 products.
  2. My sequence of interest have >80% homology with the N-term and the C-term parts of human smc1. Your antibodies NB100-78322 and NB100-204 recognized the N-term and C-term of human smc1 respectively, therefore it’s possible that the cross reactivity can happen. I would be very interested to test these antibodies (NB100-78322 and NB100-204). Can you provide me free sample (few ul) to do western blot. I will share the testing result with you.
    • We do not provide free samples for testing. If you are interested in testing these antibodies in an unlisted species or application, you would qualify for the Innovator's Rewards program. The way the program works is that you would purchase the antibody of interest, perform your testing using appropriate controls and then share your data with us. Upon review of your data we would issue you a voucher for a free antibody. You can find more details here.

Additional SMC1 Products

Bioinformatics Tool for SMC1 Partial Recombinant Protein (H00008243-Q01)

Discover related pathways, diseases and genes to SMC1 Partial Recombinant Protein (H00008243-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC1 Partial Recombinant Protein (H00008243-Q01)

Discover more about diseases related to SMC1 Partial Recombinant Protein (H00008243-Q01).
 

Pathways for SMC1 Partial Recombinant Protein (H00008243-Q01)

View related products by pathway.

PTMs for SMC1 Partial Recombinant Protein (H00008243-Q01)

Learn more about PTMs related to SMC1 Partial Recombinant Protein (H00008243-Q01).
 

Research Areas for SMC1 Partial Recombinant Protein (H00008243-Q01)

Find related products by research area.

Blogs on SMC1

There are no specific blogs for SMC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
SMC1 Antibody
NB100-204
Mre11 Antibody
NB100-142
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC1A
Entrez