SMARCAD1 Recombinant Protein Antigen

Images

 
There are currently no images for SMARCAD1 Protein (NBP1-85023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMARCAD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCAD1.

Source: E. coli

Amino Acid Sequence: HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMARCAD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMARCAD1 Recombinant Protein Antigen

  • ATP-dependent helicase 1
  • DKFZP762K2015
  • EC 3.6.1
  • EC 3.6.4.12
  • HEL1
  • hHEL1
  • KIAA1122ETL1DKFZp762K2015
  • subfamily a, containing DEAD/H box 1
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A containing DEAD/H box 1
  • SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin

Background

The SMARCs (SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin), and BAFs (BRG1-associated factors), have been identified as components of the mammalian SWI/SNF-like chromatin remodeling protein complexes. These multi-protein complexes are proposed to function as ATP-driven motors that translocate along DNA and destabilize nucleosomal structures to facilitate transcription factor binding. SMARCAD1/ETL1 is a unique member of this family in that it contains two DEAD/H box motifs, and thus is also a member of the DEAD/H-box-containing helicase superfamily. The chromosomal position of SMARCAD1 has been mapped, and it resides in a region rich in breakpoints and deletions associated with several human diseases. It is suggested to play a role in genetic instability and development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NB100-79809
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP
NB100-2350
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-47471
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-78759
Species: Hu
Applications: IP, WB
NBP1-84063
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB200-210
Species: Hu, Mu
Applications: IP, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85023PEP
Species: Hu
Applications: AC

Publications for SMARCAD1 Protein (NBP1-85023PEP) (0)

There are no publications for SMARCAD1 Protein (NBP1-85023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCAD1 Protein (NBP1-85023PEP) (0)

There are no reviews for SMARCAD1 Protein (NBP1-85023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMARCAD1 Protein (NBP1-85023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCAD1 Products

Research Areas for SMARCAD1 Protein (NBP1-85023PEP)

Find related products by research area.

Blogs on SMARCAD1

There are no specific blogs for SMARCAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCAD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCAD1